DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and CG11127

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_610283.1 Gene:CG11127 / 35673 FlyBaseID:FBgn0033178 Length:449 Species:Drosophila melanogaster


Alignment Length:122 Identity:27/122 - (22%)
Similarity:49/122 - (40%) Gaps:18/122 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 VC--LKGFDF--PYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPL 334
            ||  |.||:.  .:......|:::|...:.||......|.:|..|  :.|....:||. :.|   
  Fly   203 VCVDLVGFNMTSKFARNENALLQFFLFHQALGIENFLVYNHDELP--EEVHHLLERTN-IHL--- 261

  Fly   335 TLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMP 391
               .|:|    :.....|......|:::|: ..||..||:....:.:.:..:|:..|
  Fly   262 ---YGLP----FNFPFQQSNGTRSRIHQLL-LTDCLLRNVNHAGFTLLLRPNELFFP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 27/122 (22%)
CG11127NP_610283.1 Glyco_tranf_GTA_type 223..>333 CDD:299700 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.