powered by:
Protein Alignment CG11384 and C35A5.10
DIOPT Version :9
Sequence 1: | NP_569887.1 |
Gene: | CG11384 / 31061 |
FlyBaseID: | FBgn0040363 |
Length: | 588 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023700.1 |
Gene: | C35A5.10 / 3565313 |
WormBaseID: | WBGene00044016 |
Length: | 286 |
Species: | Caenorhabditis elegans |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 14/36 - (38%) |
Gaps: | 10/36 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 405 AHALEVEKGGKCA-GRFPA---------LCFINSYF 430
:..|...|.|.|. |..|. ||:.:|||
Worm 250 SQVLSTTKLGPCVDGACPLPGYTCGVGDLCYPDSYF 285
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG11384 | NP_569887.1 |
Glyco_transf_92 |
271..551 |
CDD:279961 |
11/36 (31%) |
C35A5.10 | NP_001023700.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4735 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.