DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and ZK381.8

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001023614.2 Gene:ZK381.8 / 3564846 WormBaseID:WBGene00044352 Length:524 Species:Caenorhabditis elegans


Alignment Length:405 Identity:74/405 - (18%)
Similarity:129/405 - (31%) Gaps:142/405 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRLTILVTVAVLAIFVLLSALQRTDHLKPTPLGQYGVSVEAGLAAKVTPPPIRHLEEPIKEELV- 71
            |.||:|:.|.....|..|.....||........||....|:      .|.|      |:|..|: 
 Worm     9 IFLTLLIVVLFYYSFQELKKTIETDISNFESSSQYSTESES------EPEP------PLKPGLLI 61

  Fly    72 ---RQLEQELPE----VDYGFWYHWAKPMGYK-INKTCAVYPDPLDLQLHNIYWQTFVNANVTFR 128
               |:|.::||.    :...::|..:|.:|.. :..|..|  |.::..:.|..:.. |.:|.|..
 Worm    62 DPTRRLTRKLPVSHVFITSAYYYPTSKSLGSNAVAFTMVV--DSINFNVENATYNV-VGSNGTHT 123

  Fly   129 LYAAYLDKRKGLKLPTVR---ILATANQIDNEFPPTHCQMWFEGYRQPIFVPVAEFLSVWVEAWG 190
            .......:.:|  :||.|   ::|..|.:.|   .|..:|...|              |.||   
 Worm   124 ELTVATSQVEG--VPTCRYTPVMARTNSVAN---MTKLKMESNG--------------VIVE--- 166

  Fly   191 NKPNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNP 255
                          :|.::...|.   ||                          ||:|..|.  
 Worm   167 --------------IPFKMARYTA---PK--------------------------PVIICISP-- 186

  Fly   256 KSQNATIQSQNEALQNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVL 320
                   |...|..|.|        ..::.::.|.           ...::.|:..:..:...::
 Worm   187 -------QFVAEQWQIF--------MMHIHVANRF-----------GGHLHIYLTSIIDSFFNLM 225

  Fly   321 DYYQRTGYLELRPLTLANGMPRLRHYQHMLLQHRK---------LEKRLNELIPYNDCFYRNLYR 376
            ..|:|.||:            .|.::..|...:.|         :|.| |:.....||..:....
 Worm   226 KEYERQGYI------------TLDYWLRMKFSNTKTPYFEPNENIEWR-NQAGAQTDCLLQYKEA 277

  Fly   377 HDYLVNVDVDEVIMP 391
            .:|:...|:|:::.|
 Worm   278 VEYIAFFDMDDILFP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 19/130 (15%)
ZK381.8NP_001023614.2 Glyco_transf_92 178..430 CDD:366762 27/182 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.