DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and CG3655

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster


Alignment Length:483 Identity:182/483 - (37%)
Similarity:267/483 - (55%) Gaps:57/483 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EELVRQLEQELPEVDYGFWYHWAKPMGYKINK--TCAVYPDPLDLQLHNIYWQTFVNANVTFRLY 130
            ::|||.:|..:|.:...:   |:|...:...|  |||.||...:|:.:||||||...:|.||:|:
  Fly    81 DQLVRDVESRIPSLPIAY---WSKNKNFLQQKSSTCAKYPSIFELEFNNIYWQTLRTSNGTFQLF 142

  Fly   131 AAYLD-KRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQPIFVPVAEFLSVWVEAWGN-KP 193
            .||.| :|..|..||||||...::|:.:. .|:||.||:|.::|..|...|:..:|...||| |.
  Fly   143 GAYYDIRRTSLLGPTVRILGMIDRIEPKV-KTYCQFWFDGQKEPFIVKTFEYKYIWYNKWGNYKQ 206

  Fly   194 NLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQ 258
            .:..|:|::|    ::|.|.....|.:||:|.:.|:.|.|:|||..||        ||....|  
  Fly   207 GIYQPYLIAC----QIPKPFHGVVPSSVSMVEKECDTATNNLRVIYNR--------PPDDQKK-- 257

  Fly   259 NATIQSQNEALQNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYY 323
                        .|.||:||.||.|.|||.|||||.|:..||||.:||.|...|||.:.:||::|
  Fly   258 ------------GFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFYNLQVHPNITKVLNHY 310

  Fly   324 QRTGYLELRPLTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEV 388
            ::.|.:::.||||..|.|.:..:||:.|..:...||.||:||||||.|:|||.:||:..:|:|||
  Fly   311 EQEGKVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEV 375

  Fly   389 IMPLGDNRNWHQLVQKA--HALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHE---EQAIAGE 448
            |||.|....|.:|:.|.  .:.:::..|     |.:..|.|.||    .:...||   .:.|...
  Fly   376 IMPKGGAVLWSELMDKVRPESRKIKPDG-----FHSYNFRNVYF----LDDQQHEHGWHKDIPKY 431

  Fly   449 LYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYR---- 509
            :::|||..|.|||:.|.:..||||:....|||||||.|..|.|.|....::|..||:||||    
  Fly   432 MHMLQHVHRAKNYTKPNQYVKCFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRADCV 496

  Fly   510 ----EPDDKYNLTNLTDDRSVWKFAGEL 533
                :..::|. .:..:|:::||:..||
  Fly   497 KTLKKSCEEYR-EHSVEDKTIWKYKDEL 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 112/276 (41%)
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 113/291 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449443
Domainoid 1 1.000 160 1.000 Domainoid score I2463
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I2533
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 1 1.000 - - FOG0012699
OrthoInspector 1 1.000 - - otm14086
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13549
109.900

Return to query results.
Submit another query.