DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and ZK381.2

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_501075.1 Gene:ZK381.2 / 191306 WormBaseID:WBGene00022725 Length:503 Species:Caenorhabditis elegans


Alignment Length:264 Identity:51/264 - (19%)
Similarity:100/264 - (37%) Gaps:62/264 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 IYAYMYDVHPAVQRVLDYYQRTGYLELRP-LTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYND 368
            ::.|:..:..:..:::..|:|.||:.|.. |.:.....:..:|:    .:..:|.| ::.....|
 Worm   188 LHIYLTSIIESYFQLMQEYERQGYITLDYWLRMKFSNTKTPYYE----PNENVEWR-HQAGAQTD 247

  Fly   369 CFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCFINSY---- 429
            |..:.....:|:...|:|:::.|    :|:...:::.:::.....||            :|    
 Worm   248 CLLQYKEAAEYIAFFDMDDILFP----KNYPTYLEEFNSVLAANPGK------------NYLFYG 296

  Fly   430 -----FTKVP--TEFSNHEEQAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHN--HFT 485
                 |.|..  ||||..|      .:..|:.:|.:|...:..|.     .|..|..:||  |.:
 Worm   297 RREHEFVKASTLTEFSFTE------LVQSLRSSQTVKRGKVVVRP-----EAYNSTWIHNSKHVS 350

  Fly   486 LKWLPGGCNPRTLNTSIAQMQHYREPDDKYNLTNLTDDRSVWKFA-GELRAAVEYVWLHLDDVLA 549
            .:        .::......:.|.:.|.||....|  |.|.:||.. |.|...:..     ||:.|
 Worm   351 FE--------TSVQVKSPTLVHVQLPVDKNGKRN--DSRDLWKIKFGPLNETIRE-----DDIRA 400

  Fly   550 QVSD 553
            ...|
 Worm   401 IEDD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 50/260 (19%)
ZK381.2NP_501075.1 Glyco_transf_92 156..408 CDD:279961 51/264 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.