DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and Y105C5B.25

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_502914.1 Gene:Y105C5B.25 / 190901 WormBaseID:WBGene00013662 Length:462 Species:Caenorhabditis elegans


Alignment Length:487 Identity:102/487 - (20%)
Similarity:183/487 - (37%) Gaps:113/487 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IYWQTFVNANVTFRLYAAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQPIFVPVA 179
            |::...|.|..::.::...:|.      ..|.||.:..|       .|.|.|.....|.......
 Worm     8 IFFLLVVFALASYFIFVEEIDN------SDVTILNSTYQ-------CHIQPWNFVNTQSTDTSYL 59

  Fly   180 EFLSVW--------VEAWGNKPNLN------YPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEK 230
            ...|.|        ||...|...::      ||..:|..:      .|.:|..|  .|..|:.:.
 Worm    60 NRFSKWLWIKFYLPVENLHNNTEISILAAYVYPDHISITL------ITQHSIKK--QLYCRYYDC 116

  Fly   231 AGNSLRVNMNRKQSLPVVIPPS--QNPKSQNATIQSQNEALQN------FGVCLKGFDFPYVDLS 287
            ..|.:|    ....|..|.|.|  |.|:...|...|.:|.|:.      .|:..:.|:.|..:||
 Worm   117 KRNEIR----GSAWLGTVFPESVIQCPRRIGAEFVSVSENLEKESDITPVGLTFRVFEEPIHELS 177

  Fly   288 E-------------RLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANG 339
            .             .:|::.|..::.|||..|.|:.::....|::||.|.|||.:||..|     
 Worm   178 VCVAPMYGNEPSWLPIIDFVEHNKLEGASYFYFYVGEIRDYDQKILDDYVRTGDIELVKL----- 237

  Fly   340 MPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQK 404
              :.::::..:..|         |:...||..|:.|...:...:|:||.:...|..    .::..
 Worm   238 --QDKYHRVFIAWH---------LLQIQDCHLRSAYHSKWTAFIDLDERLSTNGPG----TMIDV 287

  Fly   405 AHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEEQAIAGELYVLQHTQRIKNYSMPGRATK 469
            ..:::....|:...:...:.....|    |.::.|.|:  :..||...::.:.:|. :|.|  ||
 Worm   288 LRSIQDSSVGEVQLQSTTIVKDQDY----PDKYENIEQ--LEQELIFKKYNETVKK-TMSG--TK 343

  Fly   470 -CFHNARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYRE-------------PDDKYN---- 516
             ...:.::.|...:..:.|:.  |.....||.::|.::|.|.             ||:..|    
 Worm   344 PIIKSEKIGLMSIHQASAKYF--GVKTLLLNITVASVRHLRSVKHRISGSDWNKMPDETGNPIEF 406

  Fly   517 LTNLTDDRSVWKFAGELRAAVEYVWLHLDDVL 548
            :|....|    :|:|:||.||....||:.:.:
 Worm   407 VTRPLPD----EFSGKLREAVVKRVLHVYETI 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 65/315 (21%)
Y105C5B.25NP_502914.1 Glyco_transf_92 174..419 CDD:366762 56/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.