DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and subs-4

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_499465.3 Gene:subs-4 / 189978 WormBaseID:WBGene00012939 Length:523 Species:Caenorhabditis elegans


Alignment Length:321 Identity:64/321 - (19%)
Similarity:117/321 - (36%) Gaps:86/321 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SQNPKSQNATIQSQ----NEALQNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIYAYMYDV 312
            |..|..::|.:.:.    .|...:..||:... :.|.|. |.|:...||...:||::|...:...
 Worm   144 STTPNVEDAMLITPELPLREPRHDMVVCMAPM-YIYTDW-EILVTGIELWLAMGATKIVVPVQSA 206

  Fly   313 HPAVQRVLDYYQRTGYLELR-----PL---TLANGMPRLRHYQHMLLQHRKLEKRLNELI---PY 366
            ..|..|:|..|:|.|.:.:|     |:   |..||:...|..:         |..:|.|.   |:
 Worm   207 SNATYRILQEYERKGLVIIRTWPKWPIMSDTNPNGLVLSRGIE---------ESHVNCLFFVKPW 262

  Fly   367 NDCFYRNLYRHDYLVNVDVDEVIMPL-------GDNRNWHQLVQKAHALEVEKGGKCAGRFPALC 424
            :          |.:|..|:|:.::||       |||.   |:::...| |..:.|........:.
 Worm   263 S----------DIVVFSDIDDFLLPLDPSTISPGDNL---QILKNIFA-EHPQAGSLLFEHRDVQ 313

  Fly   425 FI------NSYFTKVPTEFSNHEEQAIAGELY-----VLQHTQRIKNYSM--------------- 463
            |:      :...|....||....:..:...::     |:.:..|:.:.:|               
 Worm   314 FVPPNRQGDQSLTNFNFEFLRSSKNKMNCNVWRMKTRVVVNASRVDSVNMHETGIHRFGYVQTRV 378

  Fly   464 PGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLNTS-IAQMQHYREPDDKYNLTNLTDD 523
            |.|....:|      ..|:|.|:.      :|..:|.| :|.|.:.:........|.:.|:
 Worm   379 PCRQAHFYH------LRHSHNTVP------SPTPINMSPLADMLNKQWQTRVEGFTGMKDE 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 60/298 (20%)
subs-4NP_499465.3 Glyco_transf_92 166..440 CDD:366762 60/299 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.