DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and T22D1.1

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_501069.2 Gene:T22D1.1 / 188738 WormBaseID:WBGene00020680 Length:528 Species:Caenorhabditis elegans


Alignment Length:387 Identity:73/387 - (18%)
Similarity:121/387 - (31%) Gaps:163/387 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SALQRT---DHLKPTPLGQYGVSVEA--GLAAKVTPPPI-------------------------- 59
            :|:.||   ::||...:...||.||.  .:|....|.|:                          
 Worm   144 TAMARTNTIENLKKLEMESNGVKVEIPFKMACYSAPKPVIICISPQFVAEQWQMFLMHVHVANRF 208

  Fly    60 -RHLEEPIKE------ELVRQLE-QELPEVDYGFWYHWAKPMGYKINKTCAVYPDPLDLQLHNIY 116
             .||...|..      ||:|:.| |....:||     |.:   .|..|....|.:|..    ||.
 Worm   209 GGHLHMYITSMIESYFELMREYERQGYLTLDY-----WLR---MKFEKIETPYFEPNG----NIE 261

  Fly   117 WQTFVNANVTFRL-------YAAYLDKRKGLKLPTVRILATANQIDNEF-------PPTHCQMWF 167
            |:....|.....|       |.|:.|      :..:...|:.:....||       |.|  ...|
 Worm   262 WRNQAGAETDCLLQYKEAAQYIAFFD------MDDILFPASYSTYLEEFNAEWAIEPNT--TSLF 318

  Fly   168 EGYRQPIFVPVAEFLS-------------------------------VWVE-AWGNKP----NLN 196
            .|.|:..||. ||.:|                               .|:. :|...|    |::
 Worm   319 YGRREHEFVK-AETMSEFSFSELVASLRSSPTVKRGKVVVKPETYNHTWIHYSWHEDPNTRHNVS 382

  Fly   197 YPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNAT 261
            :|||:.                     |.|..:|.|::...::.:.:..|:           |.|
 Worm   383 FPHLVH---------------------VQRPLQKNGHNNITHLWKMEFEPL-----------NET 415

  Fly   262 IQSQNEALQNFGVCLKGFDFPY---------VDLSERL-IEWFELQRILGA--SRIYAYMYD 311
            |:.::         :|..::.:         |::|:|| .|.|.|..:...  ...|.:::|
 Worm   416 IREED---------IKAIEYDFWRMRNQSRVVEISKRLPSEDFYLPIVFKCYYDSFYGFIFD 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 10/53 (19%)
T22D1.1NP_501069.2 Glyco_transf_92 180..432 CDD:366762 53/313 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.