DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and F22F7.3

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_503574.3 Gene:F22F7.3 / 184862 WormBaseID:WBGene00017721 Length:537 Species:Caenorhabditis elegans


Alignment Length:236 Identity:48/236 - (20%)
Similarity:103/236 - (43%) Gaps:44/236 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   303 SRIYAYMYDVHPAVQRVLDYYQRTGYLELRP-LTL----ANGMPRLRHYQHMLLQHRKLEKRLNE 362
            :.::.|:..:..:..:::..|::.|.:.:.| ||:    .:| |.|.       .:|.:|.| |:
 Worm   205 AHVHLYVVSMVESYYKLIKEYEKLGLVSIEPWLTIKFPVTDG-PYLE-------PNRNVELR-NQ 260

  Fly   363 LIPYNDCFYRNLYRH--DYLVNVDVDEVIMPLGDNRNWHQLVQKAHALEVEKGGKCAGRFPALCF 425
            ...:.||..  :|:.  .::..:|:|::::|...|..:.:       .|.|.||  :....||.:
 Worm   261 AAAHTDCIL--MYKEAVSFVGILDMDDILIPNKANSYYEE-------FEREYGG--SWYISALQY 314

  Fly   426 INSYFTKVPTEFSNHEEQAIAGELYVLQHTQRI------KNYSMPGRATKCF-HNARLSLTLHNH 483
            ..:.|..:  :.:..|.|:|:.   ::::.:|:      |::..|.|....: |.:|.|    ::
 Worm   315 GKADFETI--KVAELEAQSISA---IVKNARRLPTKDQGKSFVRPERFNSSWSHYSRNS----DN 370

  Fly   484 FTLKWLPGGCNPRTLNTSIAQMQHYREPDDKYNLTNLTDDR 524
            ..:.|.|....|.::.....|........:.| |||||..|
 Worm   371 KPMYWTPHQTVPLSMRKKAMQYNGIFHMKNMY-LTNLTKVR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 48/236 (20%)
F22F7.3NP_503574.3 Glyco_transf_92 175..442 CDD:366762 48/236 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.