DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and D1014.7

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001294733.1 Gene:D1014.7 / 183898 WormBaseID:WBGene00017020 Length:521 Species:Caenorhabditis elegans


Alignment Length:516 Identity:92/516 - (17%)
Similarity:175/516 - (33%) Gaps:192/516 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LPEVDYGFWYHWAKPMGYKINKTCAVYPDPLDLQLHNIY-----------W-----QTFVNAN-- 124
            ||.:.:.|.:      ..:.||.  ::..||.|:.:.::           |     .:..|||  
 Worm    65 LPSIGHYFTH------TTEFNKN--IHNAPLSLRENTLFAFNSSNCPYKEWNQIRTDSIPNANRH 121

  Fly   125 ----------------VTFRLYAAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQMWFEGYRQP 173
                            .:|.|.||:..:.:     .:..|.:.||....|...:|: :::.:|:.
 Worm   122 ADWAIQIKKPSKYLYHTSFALLAAFAHRDQ-----IIVTLTSENQFKFVFKTVYCR-YYDCHRKE 180

  Fly   174 IFVPVAEFLSVWVEAWGNKPNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARH--CEKAGNSLR 236
            ||.                      |..|            ..||::....||.  .|....|.:
 Worm   181 IFY----------------------HFES------------KVFPQSTVFCARRPGAEYISISEK 211

  Fly   237 VNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVC---LKGFDFPYVDLSERLIEWFELQR 298
            :|...:.|:|:|      |:        .|:....|.||   |.|.:..::.:.: .||:::|| 
 Worm   212 LNETPEYSVPIV------PR--------LNKPPHYFTVCMATLYGDEPKFLQIVD-FIEYYKLQ- 260

  Fly   299 ILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHM----LLQHRKLEKR 359
              ||:..:.|:.:|....:.:||.|.|||.:|:           ::.:.|.    .:.|      
 Worm   261 --GATFFHIYLRNVSNYDRVLLDDYVRTGDIEI-----------IKMHDHFWRDDFMWH------ 306

  Fly   360 LNELIPYNDCFYRNLYRHDYLVNVDVDEVI----------------------------------- 389
             |..|  |||.:|:.:...:...:|:||.|                                   
 Worm   307 -NAQI--NDCHHRSKFFSKWTALIDIDERIEMRDEKYKTIVNYLDTIKNLQIVNLHFKVQWVIKQ 368

  Fly   390 ----------MPLGDNRNWH--QLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEE 442
                      ..:.|..|:|  |.:.:..||..:.  ||..|...:..:..:..|  ..:|..:.
 Worm   369 NNTPATYVNDKQIIDEMNFHKYQNISQVGALWDQP--KCIIRPEKIAIMTIHVPK--AVYSGEQF 429

  Fly   443 QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTL----KWLPGGCNPRTLN 499
            ..::.::.|::|.:.:|.        :.|.||...:..|..|.:    ||:......:.:|
 Worm   430 TPVSEKIGVVRHYRNVKE--------RVFSNALQRMMSHAPFKIIPISKWIDENLTKQIIN 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 54/287 (19%)
D1014.7NP_001294733.1 Glyco_transf_92 231..476 CDD:366762 53/280 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.