DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and C18G1.7

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_504275.1 Gene:C18G1.7 / 182797 WormBaseID:WBGene00015985 Length:452 Species:Caenorhabditis elegans


Alignment Length:455 Identity:101/455 - (22%)
Similarity:158/455 - (34%) Gaps:145/455 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 NANV-TFRLY---AAYLDKRKGLKLPTVRILATANQIDNEFPPTHCQ-------MWFEGYRQPIF 175
            |.|| ||.:.   .||:|.|  :..|.:|:          |...||.       :.||.|:|...
 Worm    33 NKNVNTFPIVFYKDAYVDLR--MSPPKLRV----------FSLNHCLINGSFLIIRFEDYKQENI 85

  Fly   176 VPVAEFLSVWVEA---WGNKPNLNYPHLLSCPVPSELPPPTVNSFPKTVSLVARHCEKAGNSLRV 237
                :.|...:||   |...||        |...|.:...::.:.|....|..|......|...:
 Worm    86 ----KMLGEPIEADCPWSWAPN--------CYYSSHVFEVSLYNVPLEELLKIRKVNILINGKVI 138

  Fly   238 NMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVCLKGFDFP--YVDLSERLIEWFELQRIL 300
            ::|.||.:|                    :......:|::    |  :.:..:.:|.:.|..|..
 Worm   139 DLNIKQVMP--------------------KLKDGLTICVQ----PVYWYNQFQNIILFIESWRNQ 179

  Fly   301 GASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPL----TLANGMPRLRHYQHMLLQHRKLEKRLN 361
            |||....|.:.....|:.|||:||:.|.|.:.|.    ||....|.:                  
 Worm   180 GASHFIVYFHSSTKEVKMVLDHYQKLGILTIMPWPTFGTLPTQFPNI------------------ 226

  Fly   362 ELIPYNDCFYRNLYRHDYLVN-------------VDVDEVIMPLGDNRNWHQLVQKAHALEVEKG 413
                 |...||  ..|:...|             ||.||:|:|    :|.:..|.   ||.::|.
 Worm   227 -----NSQVYR--VGHNLAANLCVLEMKTTLGSIVDFDELIVP----KNGYSSVL---ALSIQKL 277

  Fly   414 GKCAGRFPALCFINSYFTKVPTEFSNHEEQAIAGELYVLQHTQRIKNYSM---PGRATKCFHNAR 475
            |:  ....||.|.|   |:|..:.||.:...         .|..:||.::   .|.....|..:.
 Worm   278 GQ--ENVGALEFEN---TRVQLDLSNDKTGF---------DTSSLKNPALVDKKGPPKLIFKTSS 328

  Fly   476 LSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQHYREPDDKYN----LTNLTDDRSVW---KFAGEL 533
            :.:.| .|...|::.  ...|||..:...:.|||     ||    |:....|.|::   .|.|.:
 Worm   329 IEIIL-THSVRKFIK--TTDRTLKVAHGTLIHYR-----YNGGKLLSKKMKDFSIFDGHNFDGHI 385

  Fly   534  533
             Worm   386  385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 67/292 (23%)
C18G1.7NP_504275.1 Glyco_transf_92 152..396 CDD:366762 67/292 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.