DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and C13A2.5

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_504849.2 Gene:C13A2.5 / 182553 WormBaseID:WBGene00015722 Length:536 Species:Caenorhabditis elegans


Alignment Length:477 Identity:85/477 - (17%)
Similarity:142/477 - (29%) Gaps:182/477 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 FEGYRQPIFVPV-----AEFLSVW----------------VEAWGNKPNLNYPHLLSCPVPSELP 210
            ||.|||  |.|:     .:|...|                :..| |...:|       .:..:||
 Worm    15 FECYRQ--FAPLKWHCRKDFHRGWTIYFLFLLMTLLFILIISMW-NTREIN-------KLIKKLP 69

  Fly   211 PPTVNSFPKTVSLVARH-----------CEKAG-NSLRVNM------NRKQSLPVVIPPSQNPKS 257
            .....|...|.:|...|           .:..| |::.|||      :...:.......|.|..:
 Worm    70 DIHNQSHALTENLAVSHIFIVSAYYYPISKSLGRNAIAVNMVIDSKNSHMNTTSHYFVGSNNSYT 134

  Fly   258 QNATIQSQNEALQNFGVCLKG-----------------------FDFPY------------VDLS 287
            |.:....::|.::   ||..|                       |:.|:            ..:|
 Worm   135 QKSVAVLESETIE---VCRYGSAVAMATMVDNLNRLEVESGGTRFEIPFKIARYTAPKPVIFCIS 196

  Fly   288 ERLI--EW------FELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELR------------ 332
            .:.:  :|      ..:....||..| .|:..:..:...::..|:|.||:.:.            
 Worm   197 PQFVAEQWEIFVFHVHVAHRFGAHMI-IYLTSIVDSYFELMQEYERIGYITIEKWLKMKFNNPET 260

  Fly   333 PLTLANGMPRLRH----YQHMLLQHRKLEKRL------NELIPYNDCFYRNLYRHDYLVNVDVDE 387
            |....|....||:    :...|||:::..:.:      :.|:|.|...|...:.|::..|.....
 Worm   261 PFFEPNLNTELRNQAGAHADCLLQYKEAAQFISFFDMDDILVPLNYPTYFQEFTHEFNKNPGARS 325

  Fly   388 VIMPLGDNR----------NWHQLVQKAHALEVEKGGKCAGRFPALCFINSYFTKVPTEFSNHEE 442
            :.....::|          |:|::||.                     :.|..||.|       :
 Worm   326 IFYGRREHRFTKGGSFSKFNFHEIVQS---------------------LESSLTKAP-------K 362

  Fly   443 QAIAGELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKWLPGGCNPRTLNTSIAQMQH 507
            ..|..|||........|....|.:..               ||   |.||  |.....||.   |
 Worm   363 PVIKPELYNSMGIHGSKRDRNPNKQA---------------FT---LTGG--PLITVPSII---H 404

  Fly   508 YREPDDKYNLTNLTDDRSVWKF 529
            .:.|..|   ...:|...:|||
 Worm   405 VQRPIGK---DGPSDVHQLWKF 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 58/334 (17%)
C13A2.5NP_504849.2 Glyco_transf_92 189..448 CDD:366762 53/290 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.