DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and C13A2.1

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_504854.4 Gene:C13A2.1 / 182549 WormBaseID:WBGene00015718 Length:498 Species:Caenorhabditis elegans


Alignment Length:409 Identity:71/409 - (17%)
Similarity:118/409 - (28%) Gaps:182/409 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LVTVAV-LAIFVLLSALQRTDHLKPTPLGQYGVSVEAGLAAKVTPPPIRHLEEPIKEELVRQLEQ 76
            |:.||: |.||||.|                       |..|..|||...:|.|:|         
 Worm     6 LIHVAIFLLIFVLYS-----------------------LFKKSPPPPSVKIELPVK--------- 38

  Fly    77 ELPEVDYGFWYHWAKPMGYKINKTCAVYPDPLDLQLHNIYWQTFVNANVTFRLYAAYLDKRKGLK 141
                                          ||...:::.|                |....|.|.
 Worm    39 ------------------------------PLKAFIYSAY----------------YYPTSKSLG 57

  Fly   142 LPTVRILATANQIDNEFPPTHCQMWFEGYRQPIFVPVAEFLSVWVEAWGNKPNLNYPHLLSCPVP 206
            ...:.:|.:.|     .|||                                    || .|.|..
 Worm    58 DNALALLMSIN-----LPPT------------------------------------PH-FSTPDF 80

  Fly   207 SELPPPTVNSFPKTVSLVAR----------HC---------EKAGNSLRVNMNRKQSLPVVIPPS 252
            .|:.....||   |.|:|.|          ||         :...|..::.|.....:..:  |.
 Worm    81 KEIIISAENS---TSSIVVRTPHHKVNYNDHCLIMTIFATAQLIPNVEKIKMVSDDGMTEI--PF 140

  Fly   253 QNPKSQNATIQSQNEALQNFGVCLKGFDFPYVDLSERLIEWFELQRILGASRIY--------AYM 309
            ..|...|..:.          ||:..     :.:||   :|   |..|.|..||        .|:
 Worm   141 TKPSYVNRDVV----------VCVAP-----LFVSE---QW---QNFLFAVHIYKKYGAFVNLYL 184

  Fly   310 YDVHPAVQRVLDYYQRTGYLELRPLTLA--NGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYR 372
            .........::..|:..|||.::|....  :|:|:.     :...:.::|.| ::....:||..:
 Worm   185 ISAVNTFYNLMKEYEEAGYLSIKPWVYVKFSGIPKA-----IADTNSQIELR-SQAAAQSDCLLQ 243

  Fly   373 NLYRHDYLVNVDVDEVIMP 391
            ......:::..::::||:|
 Worm   244 YKEAAKFIMFFELEDVIIP 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 25/131 (19%)
C13A2.1NP_504854.4 Glyco_transf_92 148..403 CDD:366762 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.