DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and C01G5.9

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_500991.2 Gene:C01G5.9 / 182076 WormBaseID:WBGene00015311 Length:426 Species:Caenorhabditis elegans


Alignment Length:328 Identity:69/328 - (21%)
Similarity:118/328 - (35%) Gaps:82/328 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 ELPPPTVNSFPKTVSLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNF 272
            |:....|..||:.....:.........:.|.:|:|.     :|.:.....:....::::|    |
 Worm   121 EIYQKAVAVFPELTIKCSESSSVKAEFVAVTINKKD-----VPGNMKQIYKEKETKNKSE----F 176

  Fly   273 GVCLKGF--DFPYVDLSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPL- 334
            .|||...  :.|.|.:....||:::||   ||.....|.:::....:.|||:|:.:..||:..: 
 Worm   177 TVCLAPLYGESPKVLMLMEFIEYYKLQ---GADHFLIYSFNISKETENVLDFYRNSSNLEVIQMG 238

  Fly   335 --TLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGD--- 394
              |......|.||  .|.||               ||.:|......::..||:||.||.:.:   
 Worm   239 NETKCLNRHRCRH--EMQLQ---------------DCVFRTQKYSSWVATVDLDERIMMIDEKST 286

  Fly   395 ------NRNWHQLVQ-------KAHALEVEKGGKCAGRFPALCFIN-------SYFTKVPTEFSN 439
                  |.|.|::.:       .....|:..|.......|.:.:.|       ::.||......|
 Worm   287 LLDYIRNCNDHKISELRFRCQWTLRYSEISSGAPQIENLPMITWHNTSHVAPQNHTTKSIIRSRN 351

  Fly   440 HEEQAIAG----------------ELYVLQHTQRIKNYSMPGRATKCFHNARLSLTLHNHFTLKW 488
            .:...:.|                |:.|::|.:.||.:|...|..:.|.|       ..||.|. 
 Worm   352 VDSMGVHGVQKFRNPIYGVRLVEPEIAVVRHYRLIKGWSFFLREAESFGN-------FFHFQLS- 408

  Fly   489 LPG 491
             ||
 Worm   409 -PG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 60/265 (23%)
C01G5.9NP_500991.2 Glyco_transf_92 175..415 CDD:366762 61/269 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.