DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and LOC105945137

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_004917590.2 Gene:LOC105945137 / 105945137 -ID:- Length:432 Species:Xenopus tropicalis


Alignment Length:472 Identity:102/472 - (21%)
Similarity:172/472 - (36%) Gaps:138/472 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 NIYWQTFVNANVTFR-----------------------LYAAYLDKRKGLKLPTVRILATANQID 155
            |.||....:..|.:|                       :.|.|.|.|   :...:|||...:.  
 Frog    24 NFYWSKKFHLGVAWRNIESCSVKLPQDTITPLKGTKAYVIAPYYDNR---EKDIIRILGIVHH-- 83

  Fly   156 NEFPPTHCQMWFEGYRQPIFVPVAEFLSVWVEAWGNKPNLNYPHLLSCPVPSELPPPTVNSFPKT 220
            .|....:|  :|......:...|...:::      :....::|:.|:..:.||.|..|    |..
 Frog    84 QEVEELYC--YFCCTSDTVLYTVKAVINI------HSDRFDFPYGLADIICSEPPSCT----PTH 136

  Fly   221 VSLVARHCEKAGNSLRVNMNRKQSLPVVIPPSQNPKSQNATIQSQNEALQNFGVCLKGFDFPYVD 285
            ||:.....|.           ..||......::||....|          ||.||.......|.:
 Frog   137 VSVHWSPYEP-----------HDSLTTFKILNRNPGRPTA----------NFTVCFSAMFGNYNN 180

  Fly   286 LSERLIEWFELQRILGASRIYAYMYDVHPAVQRVLDYYQRTGYLELRPLTLANGMPRLRHYQHML 350
            :.: .|:..|:.:||||..:..|:.:....:::||.||...|.:|:.|.          |.|..|
 Frog   181 VLQ-FIQTIEMYKILGAQNVMVYLNNCSRKMEKVLQYYTEEGTVEVIPW----------HIQRYL 234

  Fly   351 LQHRKLEKR------------LNELIPYNDCFYRNLYRHDYLVNVDVDEVIMPLGDNRNWHQLVQ 403
                |:...            ..::...|||.|||:|...::|..|.||:|:|. .:|.|..:::
 Frog   235 ----KVSDNWQYPNDGTEIGYYGQISALNDCIYRNMYSSKFVVLNDQDEIILPF-KHRTWDTMME 294

  Fly   404 -------KAHALEVEKGGKCAGRFPALCFINSYFT------KVPTEFSNHEEQAIAGELYVLQHT 455
                   |....:.|.     ..||.....|..||      :||.  ||..:       |:.:..
 Frog   295 SLQRKNPKVGIFQFEN-----HIFPQTVVSNGNFTNTSSWNRVPG--SNLLQ-------YIHREP 345

  Fly   456 QRIKNYSMPGRATKCFHNARLSLTLHNHFTLK------WLPGGCNPRTLNTSIAQMQHYREPDDK 514
            .|:..|:    |.|...:.|..:....|.|||      ::|       |:|::  :.|.|:| .:
 Frog   346 DRLSYYN----ARKMILDPRAVIQTSVHSTLKQYKRSMYVP-------LHTAL--VYHCRDP-LQ 396

  Fly   515 YNL--TNLTDDRSVWKF 529
            :||  .:|..||::|::
 Frog   397 HNLPRASLIKDRTIWRY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 71/292 (24%)
LOC105945137XP_004917590.2 Glyco_transf_92 166..420 CDD:396317 71/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I4894
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9412
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.