DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11384 and LOC100331417

DIOPT Version :9

Sequence 1:NP_569887.1 Gene:CG11384 / 31061 FlyBaseID:FBgn0040363 Length:588 Species:Drosophila melanogaster
Sequence 2:XP_021327770.1 Gene:LOC100331417 / 100331417 -ID:- Length:253 Species:Danio rerio


Alignment Length:244 Identity:63/244 - (25%)
Similarity:102/244 - (41%) Gaps:60/244 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 VQRVLDYYQRTGYLEL------RPLTLANGMPRLRHYQHMLLQHRKLEKRLNELIPYNDCFYRNL 374
            ::::|.||:..|.||:      :.|..::|.    ::|    :|:.......:|:..|:|.||::
Zfish    29 LEKLLKYYESEGILEIVSWPINKFLNPSSGW----NFQ----EHKGDLHYYGQLVTLNECIYRHM 85

  Fly   375 YRHDYLVNVDVDEVIMPLGDNRNWHQLVQ--------------KAHALEVEKGGKCAGRFPALCF 425
            |:..|::..|:||:|||...| |...|::              |:|.            ||...|
Zfish    86 YQSKYVLLNDIDEIIMPYKHN-NLQALMEYLQSTHPGASVFHVKSHL------------FPTTQF 137

  Fly   426 INSYFTKVPTEFSNHEEQAIAGELYVLQHTQRI---KNYSMPGRATKCFHNARLSLTLHNHFTLK 487
            ..|      .:|...|...|.| :.:::|..|.   ||...|   .|...|.|.......|.:||
Zfish   138 EES------RKFKRKEWNNIPG-VNIMEHIYRAPEPKNVYNP---AKMIINPRKVEQTSVHSSLK 192

  Fly   488 WLPGGCNPRTLNTSIAQMQHYREP-DDKYNLT--NLTDDRSVWKFAGEL 533
            :....|   .:...:::|.|.||| .:..|||  .|..|:.||.|..||
Zfish   193 YSGYYC---FVAFDVSRMIHVREPFQNGANLTKEQLLVDKRVWDFKHEL 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11384NP_569887.1 Glyco_transf_92 271..551 CDD:279961 63/244 (26%)
LOC100331417XP_021327770.1 Glyco_tranf_GTA_type 7..213 CDD:325014 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.