DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11378 and CG9917

DIOPT Version :9

Sequence 1:NP_001259120.1 Gene:CG11378 / 31060 FlyBaseID:FBgn0040364 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_001259605.1 Gene:CG9917 / 32596 FlyBaseID:FBgn0030740 Length:301 Species:Drosophila melanogaster


Alignment Length:304 Identity:112/304 - (36%)
Similarity:171/304 - (56%) Gaps:26/304 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALGALLLEVTASPSSAASSKVDPSQLGGLSAQFLPPEYRNTNVSIEDIKRIYREKCKKVNGAD-N 77
            |:.|:.|.:.|:....|...:|..|..      ||.:.|.:|.|:.|.|.::|.||.:|.|.: .
  Fly     9 AIYAIWLVIFATAGIMAQLDLDQIQTQ------LPDQLRKSNFSVNDAKELFRNKCIEVAGEEAG 67

  Fly    78 ATFYEEIERAAAKMSTCISGVVNLTALQEEMDVARPNGDLDTVFSKYCLKAPEAEACVKEFNDKA 142
            ...|.|||.....::.|::|:||.||:|:|:..|.|.|:||.||:|||.:...|..||..|..|.
  Fly    68 VEAYGEIESGFMVLTECLNGIVNYTAMQQEIQEASPKGELDVVFNKYCSRRSNAVECVDAFTAKL 132

  Fly   143 QHCLTPEEKRHQETVTRIGASVLGFACSRGGDQIALFIAEQGPECLEANKEAISNCLNQSFHQYI 207
            ..||..||:..|:.:.:|..|:|.|.|.:.||||||||||:||||:|:.|:.|..|:|.:|.:|:
  Fly   133 VPCLVQEEREGQDVIKQIIQSLLNFVCHKDGDQIALFIAEKGPECIESQKDNIQQCVNSTFSEYL 197

  Fly   208 PKDGQVPDLM-----SRPELLFSPTHCVDLQRFEACVIHHLEQCTQITTANIVQSVFRFVKNETD 267
                .|.||.     |.|:|......|.::...:|||:..||||:.||.||:|:|:|.|::|:|.
  Fly   198 ----NVSDLQDNRIRSMPKLTVGQKQCDEMLTLQACVVRKLEQCSDITPANLVESMFNFIRNQTM 258

  Fly   268 CQAWMQARANEK-PILMAASSNNTAPGLAYSLAGTLLGATILLI 310
            |      |.|:| |::.||:|..:.   .:....|.:|..:|::
  Fly   259 C------RDNQKSPLVAAAASGGSR---VFHQVWTHVGIFLLIL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11378NP_001259120.1 DUF1397 55..268 CDD:284559 91/218 (42%)
CG9917NP_001259605.1 DUF1397 44..259 CDD:284559 91/218 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468505
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BQMP
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27351
OrthoDB 1 1.010 - - D102615at50557
OrthoFinder 1 1.000 - - FOG0014278
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20997
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.