DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11378 and CG14629

DIOPT Version :9

Sequence 1:NP_001259120.1 Gene:CG11378 / 31060 FlyBaseID:FBgn0040364 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_569881.1 Gene:CG14629 / 31055 FlyBaseID:FBgn0040398 Length:319 Species:Drosophila melanogaster


Alignment Length:323 Identity:126/323 - (39%)
Similarity:187/323 - (57%) Gaps:23/323 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKYGMVGVCLLAALGALLLEVTASPSSAASSKVDPSQLGG-----LSAQFLPPEYRNTNVSIED 60
            |:.:.:..:.|..|:.|:|..|..:.|      :|||.|..     |.:.:||...:||||::.|
  Fly     1 MSSWSLCPLLLAFAVHAVLGSVDLAGS------LDPSLLENVDVDQLRSNYLPQGLQNTNVTLAD 59

  Fly    61 IKRIYREKCKKVN-----GADNAT-FYEEIERAAAKMSTCISGVVNLTALQEEMDVARPNGDLDT 119
            .::..:.||:|.|     |:.||: ..:.||.|...::.|:||:.|:|.:|.|::.|.|.||||.
  Fly    60 FQKWLQSKCEKANDHLPKGSVNASALSKSIEDAGIHLAECLSGLANMTEIQAEIEEASPKGDLDV 124

  Fly   120 VFSKYCLKAPEAEACVKEFNDKAQHCLTPEEKRHQETVTRIGASVLGFACSRGGDQIALFIAEQG 184
            ||.||||:.|:|:.|:|.|||....|||.:||.|...:.||...:|.|.|.:.||||||||||:|
  Fly   125 VFEKYCLRLPQAKTCLKNFNDAILPCLTTDEKTHNAVLQRIADKLLEFICYKNGDQIALFIAEEG 189

  Fly   185 PECLEANKEAISNCLNQSFHQYIPKDGQVPDLMSRPELLFSPTHCVDLQRFEACVIHHLEQCTQI 249
            ||||:.::|.|:||||.||..|:||  .:......|:|:..|..||||..||.|.:..||:|..|
  Fly   190 PECLQQSREGIANCLNSSFAGYLPK--SISPEWDLPQLVLGPKQCVDLYAFETCTVSLLEKCDTI 252

  Fly   250 TTANIVQSVFRFVKNETDCQAWM-QARANEKPILMAASSNNTAPGLAYSLAGT---LLGATIL 308
            |.:|||:|:||:|:.|:.||..: :.:...:..|...|.:.:...::..|..|   ||.||.|
  Fly   253 TPSNIVESMFRYVRKESSCQPHIDRVKLQHRRALPLTSGSQSGSSVSLHLTWTSASLLMATFL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11378NP_001259120.1 DUF1397 55..268 CDD:284559 99/218 (45%)
CG14629NP_569881.1 DUF1397 54..271 CDD:284559 99/218 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468504
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27351
OrthoDB 1 1.010 - - D102615at50557
OrthoFinder 1 1.000 - - FOG0014278
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20997
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.