DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and EIF4E2

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_004837.1 Gene:EIF4E2 / 9470 HGNCID:3293 Length:245 Species:Homo sapiens


Alignment Length:203 Identity:67/203 - (33%)
Similarity:112/203 - (55%) Gaps:8/203 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   218 DNSLEFLSLNNKCDDDLTIAAENAELLEVEDPQHPLNNCWTLWYLEN-----DRNKSWEEMLHKV 277
            :||.:......|.:.|...::...:.:.....:|||...:|.||...     ..::|:|:.:.::
Human    21 ENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQI 85

  Fly   278 TSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSF 342
            .:|.:||:||...:|:..|.:|...||:.|||:||:|||||:||.|||:|:|.|.|.   .....
Human    86 GTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKG---LASRC 147

  Fly   343 WMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVL 407
            |.:.:|.::||.....:::||.||::|.:.:.|||||....:|.|...|...||:||.:....::
Human   148 WENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIM 212

  Fly   408 EYQLHKDS 415
            ||:.|.||
Human   213 EYKTHTDS 220

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 55/158 (35%)
EIF4E2NP_004837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52 4/30 (13%)
EIF4EBP1/2/3 binding. /evidence=ECO:0000269|PubMed:17368478 54..57 2/2 (100%)
IF4E 55..214 CDD:396291 57/161 (35%)