DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eIF4E3

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_174252.2 Gene:eIF4E3 / 839836 AraportID:AT1G29590 Length:240 Species:Arabidopsis thaliana


Alignment Length:249 Identity:75/249 - (30%)
Similarity:125/249 - (50%) Gaps:23/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 RLSEQKLLSLRLEPRIKQNTCPPAKKEDAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVEDP 249
            |:::|     .::|....:..|..|...|:.|.....:..|...|     ..|::.:  ..|...
plant    11 RMADQ-----NIDPNTTTSPSPIEKHVSAIKAISGDEKAPSKEKK-----NYASKKS--TTVIQK 63

  Fly   250 QHPLNNCWTLWYLENDRNKS----WEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKK 310
            .|...|.||.|: :|..:||    |...|..:.:|.|:|:||||..:|.||::.:.|||...||.
plant    64 SHCFQNSWTFWF-DNPSSKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKD 127

  Fly   311 GIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKI 375
            .|.|.|||....|||:|.:...::   .|:|.|::.:|.|:||.....|::||.|:|.|.:.::|
plant   128 KIEPKWEDPICANGGKWTMFFPRA---TLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRI 189

  Fly   376 SIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            |:|.....|:...|.||:..:::|..::  .:.:.:|:|:| .|....||.|||
plant   190 SLWTKKAANEEAQLSIGKQWKELLGYND--TIGFIVHEDAK-TLDRDAKRRYTV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 54/157 (34%)
eIF4E3NP_174252.2 IF4E 67..221 CDD:366742 54/159 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.