DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and LSP1

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001332369.1 Gene:LSP1 / 833534 AraportID:AT5G35620 Length:198 Species:Arabidopsis thaliana


Alignment Length:184 Identity:64/184 - (34%)
Similarity:98/184 - (53%) Gaps:7/184 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 AAENAELLEVEDPQHPLNNCWTLWYLENDRNK--SWEEMLHKVTSFDTVEKFWSLITHIKPPSEL 299
            ||......|.|...|.|...|:.|: :|...|  :|...|.|..:|||||.||.|...|...|:|
plant    12 AAAELPATEAEKQPHKLERKWSFWF-DNQSKKGAAWGASLRKAYTFDTVEDFWGLHETIFQTSKL 75

  Fly   300 MLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGV 364
            ...::..|||.|:.|.|||....|||:|...:|.:.|.|||..|::.::.||||....:|::|||
plant    76 TANAEIHLFKAGVEPKWEDPECANGGKWTWVVTANRKEALDKGWLETLMALIGEQFDEADEICGV 140

  Fly   365 VVNIR--GKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSK 416
            |.::|  .|.:|:|:|.....|:..::.||:..:::|  |....:.:..|.||:
plant   141 VASVRPQSKQDKLSLWTRTKSNEAVLMGIGKKWKEIL--DVTDKITFNNHDDSR 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 55/157 (35%)
LSP1NP_001332369.1 IF4E 27..185 CDD:396291 56/160 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.