DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and EIF4E

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_193538.1 Gene:EIF4E / 827529 AraportID:AT4G18040 Length:235 Species:Arabidopsis thaliana


Alignment Length:227 Identity:82/227 - (36%)
Similarity:115/227 - (50%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 SLNNKCD------DDLTIAAENAELLEVED------------PQ-HPLNNCWTLWYLEN----DR 266
            |:.|..|      ||    ||..|:...|.            |: |||.:.||.|: :|    .:
plant    19 SIENPIDRYHEEGDD----AEEGEIAGGEGDGNVDESSKSGVPESHPLEHSWTFWF-DNPAVKSK 78

  Fly   267 NKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINL 331
            ..||...|..|.:|.|||:||||..::|.||:|..|:|:..||..|.|.|||....|||:|.:..
plant    79 QTSWGSSLRPVFTFSTVEEFWSLYNNMKHPSKLAHGADFYCFKHIIEPKWEDPICANGGKWTMTF 143

  Fly   332 TKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILR 396
            .|...   |..|:..:|.||||...|.|::||.|||||||..:||||..:..|:...:.||:..:
plant   144 PKEKS---DKSWLYTLLALIGEQFDHGDEICGAVVNIRGKQERISIWTKNASNEAAQVSIGKQWK 205

  Fly   397 KVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYT 428
            :.|..:|  .:.:.:|:|:| ||....|..||
plant   206 EFLDYNN--SIGFIIHEDAK-KLDRNAKNAYT 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 61/157 (39%)
EIF4ENP_193538.1 IF4E 61..216 CDD:396291 63/160 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.930

Return to query results.
Submit another query.