DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eif4ea

DIOPT Version :10

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_571808.1 Gene:eif4ea / 79380 ZFINID:ZDB-GENE-040413-1 Length:215 Species:Danio rerio


Alignment Length:191 Identity:93/191 - (48%)
Similarity:129/191 - (67%) Gaps:3/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ELLEVED-PQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDY 305
            :::.:|| .:|||.|.|.||:.:||::|:|:..|..::.|||||.||:|..||:..|.||.|.||
Zfish    25 QIVSLEDYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDY 89

  Fly   306 SLFKKGIRPMWEDEANVNGGRWVINLTKSAKMA-LDSFWMDAMLCLIGEAC-KHSDDLCGVVVNI 368
            ||||.||.||||||.|..||||:|.|:|..:.| ||.||::.:|||:|||. .||||:||.||||
Zfish    90 SLFKDGIEPMWEDERNKRGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNI 154

  Fly   369 RGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            |.|.:||:||..|..|:..::.|||:.::.|.:....::.||.|.|:..|.|||.|..:.|
Zfish   155 RTKGDKIAIWTTDYENKDAIVHIGRVYKERLGVPPKVIIGYQSHADTATKSGSTTKNKFVV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 252..409 CDD:460281 80/158 (51%)
eif4eaNP_571808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
IF4E 36..195 CDD:460281 80/158 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.