DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_038952114.1 Gene:Eif4e1b / 686104 RGDID:1585494 Length:263 Species:Rattus norvegicus


Alignment Length:312 Identity:96/312 - (30%)
Similarity:163/312 - (52%) Gaps:57/312 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 KGKGQGKQMVQQKENSPEQEQSTSAQYRKNVLDKDLQDK--KLIEKNMQGKIITQENLLGQKVLM 184
            :|:||.::..:::|...|:|:....:.::...::::::|  :...:.:||:   ..:|.|....:
  Rat     5 EGEGQEEEEEEEEEEEKEEEEEEEEEEKEEEEEEEVKEKPSEATAEGLQGE---ARDLPGSLKTV 66

  Fly   185 RLSEQKLLSLRLEPRIKQNTCPPAKKEDAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVEDP 249
            :...|:....:| ||                                          ||      
  Rat    67 KQKAQREHPTKL-PR------------------------------------------EL------ 82

  Fly   250 QHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRP 314
             |||...|.||:.:|||:::|::.|..||.|||||.||:...|:|..|:|..|.||:|||:||:|
  Rat    83 -HPLQFRWVLWFFKNDRSRAWQDNLQLVTKFDTVEDFWATYRHVKLASKLSCGCDYALFKEGIQP 146

  Fly   315 MWEDEANVNGGRWVINLTKSAK-MALDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRGKSNKISI 377
            ||||..|..||||:::|.|..: |.||..|::.:|||:||:. ::|.::||.|||||.|.:||::
  Rat   147 MWEDSRNKRGGRWLLSLAKQQRHMELDRLWLETLLCLLGESFEEYSGEVCGAVVNIRTKGDKIAL 211

  Fly   378 WNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            |.::..|:..|:.||.|.::.|.:....::.||.|.|:..|..|..|..:.|
  Rat   212 WTSEAENKAGVMHIGHIYKERLGLSTKTIIGYQAHADTAAKSNSLAKNKFVV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 68/155 (44%)
Eif4e1bXP_038952114.1 IF4E 84..243 CDD:396291 70/158 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.