DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and Eif4e3

DIOPT Version :10

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_080105.1 Gene:Eif4e3 / 66892 MGIID:1914142 Length:207 Species:Mus musculus


Alignment Length:151 Identity:48/151 - (31%)
Similarity:77/151 - (50%) Gaps:18/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 PLNNCWTLWYLENDRN------KSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKK 310
            ||::.||.|.   ||:      ......|.|:.:..||:.|||:..:|.|.:.|.|...|.|.:.
Mouse    31 PLHSPWTFWL---DRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRG 92

  Fly   311 GIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEA---CKHSDD-LCGVVVNIRGK 371
            ..||:||:|:|..||.|.:.:.|.   :..:.|.:.:|..|||.   |..:|| :.||.|::|.:
Mouse    93 ERRPLWEEESNAKGGVWKMKVPKD---STSTVWKELLLATIGEQFTDCAAADDEIIGVSVSVRDR 154

  Fly   372 SNKISIWNADGG--NQTTVLE 390
            .:.:.:||.:..  .:.||||
Mouse   155 EDVVQVWNVNASLVGEATVLE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 252..409 CDD:460281 48/151 (32%)
Eif4e3NP_080105.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
IF4E 31..181 CDD:460281 48/151 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.