DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eif4e2

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:171 Identity:63/171 - (36%)
Similarity:100/171 - (58%) Gaps:8/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 QHPLNNCWTLWYLEND-----RNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFK 309
            :|||...:|.||....     ..:|:|:.:.::.||.:||:||...:|:..|.:|...||:.|||
Zfish    52 EHPLQYNYTFWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFK 116

  Fly   310 KGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNK 374
            :||:|||||:||.:||:|:|.|.|.   .....|.:.:|.::||.....:::||.||::|.:.:.
Zfish   117 EGIKPMWEDDANKSGGKWIIRLRKG---LASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI 178

  Fly   375 ISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDS 415
            |||||....:|.|...|...||:||.:....::||:.|.||
Zfish   179 ISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDS 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 55/158 (35%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 57/160 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.