DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eif4eb

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001007778.1 Gene:eif4eb / 493617 ZFINID:ZDB-GENE-041121-14 Length:216 Species:Danio rerio


Alignment Length:236 Identity:105/236 - (44%)
Similarity:139/236 - (58%) Gaps:27/236 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 EPRIKQNTCPPAKKEDAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVED-PQHPLNNCWTLW 260
            ||.||.|:|   |.|:.:                .|:     .|.|::..|. .:|||.|.|.||
Zfish     5 EPEIKSNSC---KSEEEI----------------SDE-----SNQEIVSPESYIKHPLQNRWCLW 45

  Fly   261 YLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGG 325
            :.:||::|:|:..|..::.|||||.||:|..||:..|.||.|.||||||.||.||||||.|..||
Zfish    46 FFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGG 110

  Fly   326 RWVINLTK-SAKMALDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRGKSNKISIWNADGGNQTTV 388
            ||:|.|.| ..|..||.||::.:|||||||. .:|||:||.|||:|.|.:||:||.||.||:..|
Zfish   111 RWLITLNKQQRKYDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAIWTADYGNREAV 175

  Fly   389 LEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            ..|||:.::.|.:.....:.||.|.|:..|.|||.|..:.|
Zfish   176 THIGRVYKERLGVPMNMTIGYQSHADTATKSGSTTKNKFVV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 80/155 (52%)
eif4ebNP_001007778.1 IF4E 40..196 CDD:279921 80/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573562
Domainoid 1 1.000 193 1.000 Domainoid score I3137
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 216 1.000 Inparanoid score I3585
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.