DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and MGC89871

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001005099.1 Gene:MGC89871 / 448677 XenbaseID:XB-GENE-973579 Length:234 Species:Xenopus tropicalis


Alignment Length:175 Identity:67/175 - (38%)
Similarity:104/175 - (59%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 QHPLNNCWTLWYLEN-----DRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFK 309
            :|||...:|.||...     ..::|:|:.:.::.:|.:||:||...:|:..|.:|...||:.|||
 Frog    53 EHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFK 117

  Fly   310 KGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNK 374
            :||:|||||:||.|||:|:|.|.|.   .....|.:.:|.::||.....:::||.||::|.:.:.
 Frog   118 EGIKPMWEDDANKNGGKWIIRLRKG---LASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI 179

  Fly   375 ISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDS-KDK 418
            |||||....:|.|...|...||:||.:....|:||:.|.|| |||
 Frog   180 ISIWNKTASDQATTARIRDTLRRVLNLPPNTVMEYKTHTDSIKDK 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 56/158 (35%)
MGC89871NP_001005099.1 IF4E 55..214 CDD:366742 58/161 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.