DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eIF4E6

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001189306.1 Gene:eIF4E6 / 43422 FlyBaseID:FBgn0039622 Length:173 Species:Drosophila melanogaster


Alignment Length:177 Identity:81/177 - (45%)
Similarity:103/177 - (58%) Gaps:17/177 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 KEDAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVEDPQHPLNNCWTLWYLENDRNKSWEEML 274
            ||.:......||:    |||.   .::.|.|         :|.|.|.||||.::.|...|||:||
  Fly     8 KESSEFKMGTSLD----NNKL---ASLGATN---------KHRLQNTWTLWGVKYDPEISWEDML 56

  Fly   275 HKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMAL 339
            .::.||:|||.||:|...|..||:|..|.||.||||||||||||..|..||||...:.|.:...|
  Fly    57 KEIDSFNTVEDFWNLYFRIDTPSKLNRGCDYMLFKKGIRPMWEDPPNKGGGRWTYKVDKRSTAEL 121

  Fly   340 DSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIW-NADGGNQ 385
            |..|:|.:||:|||||.|.|.:||..|.||...||||:| .||.|::
  Fly   122 DKTWLDVLLCMIGEACDHCDQICGAFVRIRKNINKISVWTKADAGDE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 70/132 (53%)
eIF4E6NP_001189306.1 IF4E 37..168 CDD:279921 70/130 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470285
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I1143
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
1110.800

Return to query results.
Submit another query.