DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eif4e2rs1

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_957053.1 Gene:eif4e2rs1 / 393732 ZFINID:ZDB-GENE-040426-1728 Length:228 Species:Danio rerio


Alignment Length:223 Identity:77/223 - (34%)
Similarity:121/223 - (54%) Gaps:27/223 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 KKEDA----VVAFDNSLEFLSLNNKCDD----DLTIAAENAELLEVEDPQHPLNNCWTLWYLEND 265
            |:||.    .:..:|..:..|:||..::    .:|.||          .:|||...:|.||....
Zfish     8 KEEDCGDHEEMKDNNESDRASINNNNNNIRRKMVTPAA----------GEHPLQYNYTFWYSRRT 62

  Fly   266 -----RNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGG 325
                 ..:|:|:.:.::.:..:||:||...:|:..|.:|...||:.|||:||:||||||||.|||
Zfish    63 PSRPANTQSYEQNIRQMGTVASVEQFWKFYSHLVRPGDLTGHSDFHLFKEGIKPMWEDEANKNGG 127

  Fly   326 RWVINLTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLE 390
            :|:|.|.|.   ....||.:.:|.::||.....:::|||||:||.:.:.:||||....:|.|...
Zfish   128 KWIIRLRKG---LASRFWENIILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKTANDQVTTSR 189

  Fly   391 IGRILRKVLRMDNIYVLEYQLHKDS-KD 417
            |...||:||.:....::||:.|.|| ||
Zfish   190 IRDTLRRVLNLPPNTIMEYKTHNDSLKD 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 57/158 (36%)
eif4e2rs1NP_957053.1 IF4E 52..208 CDD:279921 57/158 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573592
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.