DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and Eif4e2

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001102278.1 Gene:Eif4e2 / 363275 RGDID:1307790 Length:174 Species:Rattus norvegicus


Alignment Length:150 Identity:58/150 - (38%)
Similarity:87/150 - (57%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 RNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVIN 330
            |.|...|:..:|     ||:||...:|:..|.:|...||:.|||:||:|||||:||.|||:|:|.
  Rat    20 RRKKQTEIRARV-----VEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIR 79

  Fly   331 LTKSAKMALDSFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRIL 395
            |.|.   .....|.:.:|.::||.....:::||.||::|.:.:.|||||....:|.|...|...|
  Rat    80 LRKG---LASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTL 141

  Fly   396 RKVLRMDNIYVLEYQLHKDS 415
            |:||.:....::||:.|.||
  Rat   142 RRVLNLPPNTIMEYKTHTDS 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 53/142 (37%)
Eif4e2NP_001102278.1 IF4E <32..155 CDD:279921 49/125 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.