DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and eIF4EHP

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:150 Identity:48/150 - (32%)
Similarity:82/150 - (54%) Gaps:6/150 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 DDDLTIAAENAELLEVEDPQHPLNNCWTLWYLENDRNKS---WEEMLHKVTSFDTVEKFWSLITH 292
            |.|..|..:|...|||...::.|.:.:.||:...:..::   :.:.||.|....:|:::|||.:|
  Fly    26 DVDNQIDVDNLPPLEVGPGENRLQHTYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSH 90

  Fly   293 IKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKH 357
            :..|:.|....:..|||:||.|||||.||..||:|:|.|.|:   .:|..|.:..:.::||....
  Fly    91 LIRPTALKPYRELLLFKQGIIPMWEDPANSKGGQWLIRLRKN---KVDRAWENVCMAMLGEQFLV 152

  Fly   358 SDDLCGVVVNIRGKSNKISI 377
            .|::||||:..:..:..|.:
  Fly   153 GDEICGVVLQTKYPNPSIQV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 40/125 (32%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 40/124 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438280
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.