DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and tif452

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_595451.1 Gene:tif452 / 2539870 PomBaseID:SPBC1709.18 Length:243 Species:Schizosaccharomyces pombe


Alignment Length:188 Identity:70/188 - (37%)
Similarity:106/188 - (56%) Gaps:6/188 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 IAAENAELLEVEDPQHPLNNCWTLWYLE-NDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSEL 299
            ::|.|||...|:  .|||.:.||||:|: ..:...|.::|.::.||.|||:||.:...|...|.|
pombe    51 LSAVNAETAFVK--THPLQHEWTLWFLKPPTQGLEWSDLLKEIISFKTVEEFWGIFKTISKASML 113

  Fly   300 MLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHS-DDLCG 363
            ...||||.|.|||||.|||..|:|||:|... :|.....||..|:..:|..|||....: .::.|
pombe   114 PAKSDYSYFLKGIRPEWEDPQNMNGGKWAYQ-SKHKGSNLDELWLYMVLAAIGETLDPTGKEVTG 177

  Fly   364 VVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDKLGS 421
            ||.|:|....:|::|..:..::..:.:||...::||.:.:...:||..|:|| .|.||
pombe   178 VVCNMRKGFYRIAVWTRNCNDKDVLEKIGLRFKEVLGISDKETIEYSAHEDS-SKAGS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 54/155 (35%)
tif452NP_595451.1 CDC33 16..243 CDD:227386 70/188 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
109.900

Return to query results.
Submit another query.