DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001273108.1 Gene:Eif4e1b / 218268 MGIID:2685119 Length:250 Species:Mus musculus


Alignment Length:177 Identity:75/177 - (42%)
Similarity:118/177 - (66%) Gaps:4/177 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFK 309
            ||....|||...|.||:.:|||:::|::.|..||.|:|||.||::.:|||..|:|..|.||:|||
Mouse    65 EVLSKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFK 129

  Fly   310 KGIRPMWEDEANVNGGRWVINLTKSAK-MALDSFWMDAMLCLIGEAC--KHSDDLCGVVVNIRGK 371
            :||.|||||..|..||||::::.|..: ..||..|::.:|||:|. |  ::|.::||.|||||.|
Mouse   130 EGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGN-CFEEYSREVCGAVVNIRTK 193

  Fly   372 SNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKDSKDK 418
            .:||::|.::..::..|::||:|.::.|.:....::.||.|.|:..|
Mouse   194 RDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAK 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 65/156 (42%)
Eif4e1bNP_001273108.1 IF4E 75..231 CDD:279921 65/156 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830791
Domainoid 1 1.000 186 1.000 Domainoid score I3337
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3600
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8694
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.890

Return to query results.
Submit another query.