DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and EIF4E

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:222 Identity:92/222 - (41%)
Similarity:125/222 - (56%) Gaps:37/222 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EVEDPQ----HPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDY 305
            ||.:|:    |||.|.|.||:.:||::|:|:..|..::.|||||.||:|..||:..|.||.|.||
Human    27 EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDY 91

  Fly   306 SLFKKGIRPMWEDEANVNGGRWVINLTKSAKMA-LDSFWMDA----------------------- 346
            ||||.||.||||||.|..||||:|.|.|..:.: ||.||::.                       
Human    92 SLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETRWDLAMLPRLVSNFWPQVILPLQ 156

  Fly   347 --------MLCLIGEAC-KHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMD 402
                    :||||||:. .:|||:||.|||:|.|.:||:||..:..|:..|..|||:.::.|.:.
Human   157 PPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLP 221

  Fly   403 NIYVLEYQLHKDSKDKLGSTVKRIYTV 429
            ...|:.||.|.|:..|.|||.|..:.|
Human   222 PKIVIGYQSHADTATKSGSTTKNRFVV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 76/186 (41%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 78/189 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140837
Domainoid 1 1.000 187 1.000 Domainoid score I3336
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 214 1.000 Inparanoid score I3630
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8454
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.