DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and ife-4

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_508210.1 Gene:ife-4 / 180464 WormBaseID:WBGene00002062 Length:212 Species:Caenorhabditis elegans


Alignment Length:186 Identity:62/186 - (33%)
Similarity:94/186 - (50%) Gaps:10/186 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 DLTIAAENAELLEVEDPQHPLNNCWTLWYLENDRNK----SWEEMLHKVTSFDTVEKFWSLITHI 293
            :|.|..|:|   .|....|.|...:|..|......|    .:...:..|....:||:|||::.|.
 Worm    16 NLPILMEDA---PVGSDDHQLQYSYTFSYFMRPTGKFDPEDYASYVQPVGIMKSVEQFWSIMVHF 77

  Fly   294 KPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALDSFWMDAMLCLIGEACKHS 358
            |.|:|:...:|...||.|::|:|||.||..||:|:|.|.|.....:   |.:.::.:|||.....
 Worm    78 KRPTEMCDKADIHFFKTGVKPVWEDPANCKGGKWIIRLKKGLSTRI---WENLLMAIIGEQFLVG 139

  Fly   359 DDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIYVLEYQLHKD 414
            |:|||.|.:||.:.:.||:||.:..:......|...||.||::....||||:.|.|
 Worm   140 DELCGAVCSIRNQEDIISLWNRNADDTPVTNRIRETLRSVLQLPQNTVLEYKRHDD 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 51/157 (32%)
ife-4NP_508210.1 IF4E 35..190 CDD:279921 51/157 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.