DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and ife-1

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001255196.1 Gene:ife-1 / 176755 WormBaseID:WBGene00002059 Length:231 Species:Caenorhabditis elegans


Alignment Length:226 Identity:84/226 - (37%)
Similarity:128/226 - (56%) Gaps:28/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 DAVVAFDNSLEFLSLNNKCDDDLTIAAENAELLEVED---PQHPLNNCWTLWYLENDRNKSWEEM 273
            |:.:||:.              |.|:.|...:.|.|.   |.:||...||.|||.::||||||:.
 Worm     3 DSEIAFEK--------------LKISGEKEGMTETEQTTAPIYPLKRNWTWWYLNDERNKSWEDR 53

  Fly   274 LHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRW--VINLTKSAK 336
            |.||.:|:||.:||:|...|:|||.|....||::|:..|:||||...|.|||||  ||:..|:.:
 Worm    54 LKKVYTFNTVSEFWALYDAIRPPSGLNALCDYNVFRDDIQPMWEVPENSNGGRWLIVIDKGKTPE 118

  Fly   337 MALDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLR 400
            | :|:.|::.::.|:||.. |..:.:||:|.|:|||.:|||:|..|..:..|.:.||.:|::.|.
 Worm   119 M-VDAIWLEILMALVGEQFGKDMESICGLVCNVRGKGSKISVWTKDCNDDETNMRIGVVLKEKLM 182

  Fly   401 MDN-------IYVLEYQLHKDSKDKLGSTVK 424
            ..:       ..|:.|:.|:..:.|..|.||
 Worm   183 AASKDHSKPLFDVIRYEDHESCQKKTSSVVK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 67/163 (41%)
ife-1NP_001255196.1 IF4E 37..181 CDD:279921 65/144 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156160
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.