DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E7 and ife-5

DIOPT Version :9

Sequence 1:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001379255.1 Gene:ife-5 / 174871 WormBaseID:WBGene00002063 Length:201 Species:Caenorhabditis elegans


Alignment Length:195 Identity:71/195 - (36%)
Similarity:111/195 - (56%) Gaps:16/195 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 LLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLHKVTSFDTVEKFWSLITHIKPPSELMLGSDYSL 307
            :.|:..|.:||...|:.|:|.:|||.||::.|.||.:|:||.:||:....|.|||.|....||::
 Worm     1 MTELTTPIYPLQRNWSWWFLNDDRNASWQDRLKKVYTFNTVPEFWAFYEAILPPSGLNDLCDYNV 65

  Fly   308 FKKGIRPMWEDEANVNGGRWVINLTK-SAKMALDSFWMDAMLCLIGEAC-KHSDDLCGVVVNIRG 370
            |:..|:|.||...|.:||||:|.:.| .....||:.|::.:|.||||.. |..:.:||:|.|:||
 Worm    66 FRDDIQPKWEAPENWDGGRWLIIINKGKTPEVLDAVWLEILLALIGEQFGKDMESICGLVCNVRG 130

  Fly   371 KSNKISIWNADGGNQTTVLEIGRILRKVLR-----------MDNIYVLEYQLHKDSKDKLGSTVK 424
            :.:|||:|..:..:..|.:.||.:|::.|.           .|   |:.||.|::...|..|.:|
 Worm   131 QGSKISVWTKNCNDDDTNMRIGVVLKEKLMAAASKAHSKPLFD---VIHYQTHRNCVKKTTSALK 192

  Fly   425  424
             Worm   193  192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 61/166 (37%)
ife-5NP_001379255.1 IF4E 10..159 CDD:396291 60/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156159
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.