DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and RBM4B

DIOPT Version :10

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_113680.1 Gene:RBM4B / 83759 HGNCID:28842 Length:359 Species:Homo sapiens


Alignment Length:150 Identity:37/150 - (24%)
Similarity:60/150 - (40%) Gaps:25/150 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IELTSGPTGLKSRILVRNL-PVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETL 72
            :|.:...:...:::.|.|: |.||.|||......:|.::...:..:..|:...|..:|..||..|
Human    67 VEASKNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGL 131

  Fly    73 DHTTFKSKVILVSNASFRSLNA-------SCLGYAPPGQMMIEWSDEDDVD---EYDDYSESDDE 127
            |:|.|:.|.:.|..::.|...|       .|......|    .||.|..||   ...|::|..:|
Human   132 DNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEG----HWSKECPVDRTGRVADFTEQYNE 192

  Fly   128 D----------GPGDMQLYN 137
            .          |.|:...||
Human   193 QYGAVRTPYTMGYGESMYYN 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM_SF 22..85 CDD:409669 19/63 (30%)