DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and RS41

DIOPT Version :10

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_200017.2 Gene:RS41 / 835279 AraportID:AT5G52040 Length:357 Species:Arabidopsis thaliana


Alignment Length:61 Identity:17/61 - (27%)
Similarity:32/61 - (52%) Gaps:1/61 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PFGEILGSLVTNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYAP 101
            |:|:|:...:..|..|||:..:.:|..|::..:.:....|||.|..| .:..::...||:|
plant   119 PYGKIVNVRIRRNFAFIQYEAQEDATRALDATNSSKLMDKVISVEYA-VKDDDSRGNGYSP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM_SF 22..85 CDD:409669 12/43 (28%)
RS41NP_200017.2 RRM1_AtRSp31_like 2..73 CDD:409680
RRM2_AtRSp31_like 97..166 CDD:409899 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.