DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and RS31

DIOPT Version :10

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:112 Identity:28/112 - (25%)
Similarity:51/112 - (45%) Gaps:32/112 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PTGLK--SRILVRNL-PVCTRQ-ELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETLDHT 75
            |:.||  ..:.|.|. |:.|:: ::.....|:|::....:..|..|:||..:.:|..|:|    .
plant    86 PSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALE----A 146

  Fly    76 TFKSKVI--LVSNASFRSLNASCLGYAPPGQMMIEWSDEDDVDEYDD 120
            |.:||::  :||                     :|::.:|| ||.||
plant   147 TQRSKILDRVVS---------------------VEYALKDD-DERDD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM_SF 22..85 CDD:409669 16/66 (24%)
RS31NP_567120.1 RRM_SF 2..73 CDD:473069
RRM2_AtRSp31_like 94..163 CDD:409899 19/93 (20%)
PTZ00449 <138..209 CDD:185628 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.