DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and CG18823

DIOPT Version :9

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_659571.1 Gene:CG18823 / 59184 FlyBaseID:FBgn0042146 Length:106 Species:Drosophila melanogaster


Alignment Length:110 Identity:64/110 - (58%)
Similarity:76/110 - (69%) Gaps:18/110 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETLDHTTFKS 79
            ||..:|||.|||||.||||||..||||||:|||||:.:|:|||||||||||..||:.||...|||
  Fly     9 PTSPRSRIWVRNLPPCTRQELVMLCLPFGKILGSLIVDNEGFIQFARESEATSAIDALDQIVFKS 73

  Fly    80 KVILVSNASFRSLNASCLGYAPP---GQMMIEWSDEDDV---DEY 118
            ||:.||||:|           ||   ||::: |.|||.|   ||:
  Fly    74 KVLQVSNATF-----------PPIEGGQVLV-WYDEDGVYFEDEF 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 46/65 (71%)
RRM_SF 22..85 CDD:240668 44/62 (71%)
CG18823NP_659571.1 RRM <9..>79 CDD:223796 48/69 (70%)
RRM_1 16..76 CDD:278504 43/59 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442863
Domainoid 1 1.000 44 1.000 Domainoid score I4678
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_175127
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.