DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and ncoa5

DIOPT Version :9

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:XP_005166217.1 Gene:ncoa5 / 447849 ZFINID:ZDB-GENE-040912-155 Length:622 Species:Danio rerio


Alignment Length:93 Identity:26/93 - (27%)
Similarity:46/93 - (49%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSGPTGLKSRILVRNLPVC--TRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETLDH 74
            ::.|..|:.||.|.|||..  .::::..|..|:|:|....:....||:||.|..:|:.|....:.
Zfish    19 SNDPRDLERRIFVGNLPTAHMAKKDMEDLFRPYGKIQALSLFRGYGFVQFERLEDAEAAKAGHNG 83

  Fly    75 TTFKSKVILVSNASFRSLNASCLGYAPP 102
            ..::...:.|:.|:.|..|.|  ..:||
Zfish    84 RVYRGYKLDVNMAAERRQNKS--RSSPP 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM <19..>85 CDD:223796 17/67 (25%)
RRM_SF 22..85 CDD:240668 16/64 (25%)
ncoa5XP_005166217.1 RRM <1..168 CDD:223796 26/93 (28%)
RRM_hnRNPC_like 27..94 CDD:240787 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D421126at33208
OrthoFinder 1 1.000 - - FOG0006056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.