DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14628 and rbm4b

DIOPT Version :10

Sequence 1:NP_569883.1 Gene:CG14628 / 31057 FlyBaseID:FBgn0040365 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b / 394812 XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis


Alignment Length:131 Identity:34/131 - (25%)
Similarity:54/131 - (41%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IELTSGPTGLKSRILVRNLPV-CTRQELAYLCLPFGEILGSLVTNNQGFIQFARESEAKLAIETL 72
            :|.:.|.....:::.|.||.. ||.:||......:|.:|...:..:..|:...|.:||..||:.|
 Frog    67 VEHSRGKPKASTKLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKDYAFVHMERSAEALDAIKNL 131

  Fly    73 DHTTFKSKVILVSNASFR-------SLNASCLGYAPPGQMMIEWSDEDDVDEYDDYSESDDEDGP 130
            |:|.||.|.:.|..::.|       .....|......|    .||.|..:|:    ...:.|..|
 Frog   132 DNTEFKGKRMHVQLSTSRLRVTPGMGERTRCYRCGKEG----HWSKECPLDQ----MTKELEQAP 188

  Fly   131 G 131
            |
 Frog   189 G 189

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14628NP_569883.1 RRM_SF 22..85 CDD:409669 21/63 (33%)