DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and AT5G40720

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001330147.1 Gene:AT5G40720 / 834072 AraportID:AT5G40720 Length:583 Species:Arabidopsis thaliana


Alignment Length:286 Identity:47/286 - (16%)
Similarity:96/286 - (33%) Gaps:84/286 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 QPYLIACQIPKPFHGVVPSSVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLS 274
            ||..::.:|..  .|::||....:::     ...::|         .|.|..||..:.   .:.:
plant   242 QPVKVSVRIKG--SGMLPSVAHPIKR-----PGRIKV---------SKTFETCVCTMT---RNAA 287

  Fly   275 VRLIEWIEMLNILGADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLT 339
            ..|.||:.....:|..:.:.|:.....:|...:.:.|..| ..:.....|..:....||.:..:.
plant   288 NVLREWVMYHAGIGVQRWFIYDNNSDDDIVSEIKNLENRG-YNISRHFWPWIKTQEAGFANCAIR 351

  Fly   340 KKTNHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSEL------------MDKV 392
            .|            :||        |::|.:|:||......|..|.:.:            :.::
plant   352 AK------------SDC--------DWVAFIDVDEFFYIPSGQTLTNVIRNHTTTPSSSGEIGEI 396

  Fly   393 RPESRKIKPDGFH---------SYNFRNVYFLDDQQHEHGWHKDIPK-------YMHMLQHVHRA 441
            |.......|.|..         :|..|..  |.::      ||.|.:       .::::.|.|..
plant   397 RTPCHSFGPSGLRDPPRSGVTAAYTCRMA--LPER------HKSIIRPESLNATLINVVHHFHLK 453

  Fly   442 KNYTKPNQYVKCFHDPERVLTLHNHF 467
            :.:        .|.|.::...:.||:
plant   454 EEF--------AFVDVDKSTMVINHY 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 40/239 (17%)
AT5G40720NP_001330147.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.