DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and AT3G27330

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_189369.1 Gene:AT3G27330 / 822354 AraportID:AT3G27330 Length:913 Species:Arabidopsis thaliana


Alignment Length:384 Identity:78/384 - (20%)
Similarity:134/384 - (34%) Gaps:116/384 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 GVVPSSVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILG 288
            |::||....|           |:|  .||  :||.|.:||..:.   .:.:..|.||:.....:|
plant   258 GMLPSIAQPV-----------RII--NPP--RKKPFQMCVCTMT---RNAAAVLREWVMYHAGIG 304

  Fly   289 ADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPY 353
            ..:.:.|:.....:|...:.:.|:.| ..:.....|..:....||.:..:..|            
plant   305 VQRWFIYDNNSDDDIIAEIENLERRG-YNISRHFWPWIKTQEAGFSNCAIRAK------------ 356

  Fly   354 NDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWS--------ELMDKVRPESRKIKPDGFHS---- 406
            :||        |:||.:|:||......|..|.|        :.:.::|.......|.|..|    
plant   357 SDC--------DWIAFIDVDEFFYIPSGETLTSVIRNYTTTDSIGEIRTPCHSFGPSGLRSRPRS 413

  Fly   407 -----YNFRNVYFLDDQQHE----------------HGWH-----------KD---IPKYMHMLQ 436
                 |..|.|.   .::|:                |.:|           ||   |..|.:.:.
plant   414 GVTSGYTCRVVL---PERHKSIIRPEAMNATLINVVHHFHLRDGFTFADMDKDIMVINHYKYQVW 475

  Fly   437 HVHRAKNYTKPNQYVKCFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRADCVKTLKK 501
            .|.:.|.|.:...||..:.:.|.|.: .:..|  .||    :.||:..|            ..::
plant   476 EVFKEKFYRRVATYVADWQNEENVGS-RDRAP--GLG----TRPVEPSD------------WAER 521

  Fly   502 SCEEYREHSVEDKTIWKYKDELIRRTI--KALDTLGFFRRQG-----LNSASGSGSSSS 553
            .| |..:..:.|:...|:||:..:|.:  ||.:.....|...     :.:.||.||:.|
plant   522 FC-EVNDTGLRDQVFEKFKDKKTQRLVWEKAEEDDNIQRMVSETPLRVTNRSGDGSNGS 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 60/316 (19%)
AT3G27330NP_189369.1 Glyco_transf_92 276..486 CDD:279961 44/236 (19%)
RING 724..766 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.