DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and CG12910

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001260858.1 Gene:CG12910 / 36082 FlyBaseID:FBgn0033502 Length:466 Species:Drosophila melanogaster


Alignment Length:457 Identity:99/457 - (21%)
Similarity:176/457 - (38%) Gaps:109/457 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 LPIAYWSKNKNFLQQKSSTCAK--YPSIFE-----LEFNNIYWQTLRTSNGTFQLFGAYYDIRRT 151
            |.:.|.|...:..::.....||  ...|||     .:::| .|:.:..|....:::.||:| .||
  Fly    25 LVLVYISMRSSLNERLREDLAKAQRQMIFERPNPHWDYSN-SWRRIGNSTLRHEIYSAYFD-ART 87

  Fly   152 SLLG-----------PTVRILGMI-DRI-EPKVKTYCQFW-FDGQKEPFIVKTFEYKYIWYNKWG 202
            .::|           .::||..:: :|: :..:....:|. |..|:    :|..|         .
  Fly    88 DIVGNVRMDDEQMTIGSLRIFAILPERLRDSSINCIVRFSDFSSQE----IKAEE---------A 139

  Fly   203 NYKQGIYQPYLIACQIPKPFHGV------VPSSVSMVEKECDTATNNL--------RVIYNRPPD 253
            .....::.....|..|..|.|..      :|.:|::.     .|:|.|        ::.|.|...
  Fly   140 GAMHDVHNNTFAAWSIMCPLHASRRSPLRLPQAVALA-----YASNRLSHLSPTFIQISYPRNMT 199

  Fly   254 D----QKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFYNLQVHPNITKVLNHYEQEG 314
            :    .:...:|||..|...|.:: :||:|::||..:.||...|||.::....:.:||.||::.|
  Fly   200 NMFGRSRPTISVCVGPLHENYSNV-LRLVEFVEMYRLQGATHFYFYYVEASEEVLRVLEHYQRIG 263

  Fly   315 KVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPYNDCLYKNLYL--YDYIALLDIDEVIM 377
            ...|....:.....:|    |.          ...|..:|||:|:...:  :.|.|::|:|||:|
  Fly   264 LADVFEWNVQAHMQDV----HY----------AGIVAQFNDCVYRANVVDNFRYAAVVDLDEVVM 314

  Fly   378 PKGGAVLWSELMDKVR--PESRKIKPDGFHSYNFRNVYFLDDQQHEHGWHKDIPKYMHMLQHVHR 440
            |    :..:.|.|.:|  .|.|..      .:.||||:|       |  .:|.....:...||..
  Fly   315 P----LKHNTLADYLRQCDEGRTA------GFVFRNVFF-------H--RRDSNDTFNAPSHVLN 360

  Fly   441 AKNYTKPN---------QYV--KCFHDPERVLTLHNHFPLSCLGGVCKSYPVDTKDAQLQHYRAD 494
            ...||:..         .|:  |...:...::.:.||.......|.. .:.|......|.|||..
  Fly   361 RLLYTQSKVRRTLEVLPAYIRSKVVVNARAIVEMGNHQVYRAAPGYA-DHVVHPTVGLLFHYRDK 424

  Fly   495 CV 496
            |:
  Fly   425 CI 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 63/255 (25%)
CG12910NP_001260858.1 Glyco_transf_92 209..423 CDD:279961 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21461
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16972
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.