DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C35A5.10

DIOPT Version :10

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001023700.1 Gene:C35A5.10 / 3565313 WormBaseID:WBGene00044016 Length:286 Species:Caenorhabditis elegans


Alignment Length:150 Identity:29/150 - (19%)
Similarity:46/150 - (30%) Gaps:43/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 AKYPSIFELEFNNIYWQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMIDRIEPKVKTYCQFW 178
            ::||.......||        :|..|..:|... |..:|...|.:......:.:  ....|...|
 Worm    41 SQYPCNSNNNCNN--------NNCNFNNYGNQV-ILPSSFYNPNMNCNSNCNNL--NCNQYSGSW 94

  Fly   179 FDGQKEPFIVKTFEYK----------------YIWYNKWGNY-----KQGIYQPYLIACQIPKPF 222
            .:||...:.:.:..|.                ||..|..|||     ..|.|..|          
 Worm    95 LNGQYVAYNMGSNAYSPCASSCCSNNNNNYNPYINNNYNGNYNPYGTSNGGYNAY---------- 149

  Fly   223 HGVVPSSVSMVEKECDTATN 242
             |.:|.:|::.....:|..|
 Worm   150 -GTIPVNVNVPSSSTNTNVN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:426386
C35A5.10NP_001023700.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.