DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and C35A5.10

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001023700.1 Gene:C35A5.10 / 3565313 WormBaseID:WBGene00044016 Length:286 Species:Caenorhabditis elegans


Alignment Length:150 Identity:29/150 - (19%)
Similarity:46/150 - (30%) Gaps:43/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 AKYPSIFELEFNNIYWQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMIDRIEPKVKTYCQFW 178
            ::||.......||        :|..|..:|... |..:|...|.:......:.:  ....|...|
 Worm    41 SQYPCNSNNNCNN--------NNCNFNNYGNQV-ILPSSFYNPNMNCNSNCNNL--NCNQYSGSW 94

  Fly   179 FDGQKEPFIVKTFEYK----------------YIWYNKWGNY-----KQGIYQPYLIACQIPKPF 222
            .:||...:.:.:..|.                ||..|..|||     ..|.|..|          
 Worm    95 LNGQYVAYNMGSNAYSPCASSCCSNNNNNYNPYINNNYNGNYNPYGTSNGGYNAY---------- 149

  Fly   223 HGVVPSSVSMVEKECDTATN 242
             |.:|.:|::.....:|..|
 Worm   150 -GTIPVNVNVPSSSTNTNVN 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961
C35A5.10NP_001023700.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.