DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and ZK1025.4

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001040719.1 Gene:ZK1025.4 / 191493 WormBaseID:WBGene00014184 Length:452 Species:Caenorhabditis elegans


Alignment Length:312 Identity:65/312 - (20%)
Similarity:124/312 - (39%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KNKNFLQQKSSTCAKYPSIFELEFNNIYWQTLRTSNGTFQLFGAYYDIRRTSLLGPTVRILGMID 165
            :|::.|  |:...|.:|..|   ::.:| ...|||....::|.....|:.::.|...|...|.|.
 Worm    24 QNQSLL--KNQINASFPITF---YHKVY-VDYRTSPPRLRIFSLNPCIKASNYLLVHVYYNGTIT 82

  Fly   166 RIEPKVKTYCQFWFDGQKEPFIVKTFEYKYIWYNKWGNYKQGIYQPYLIACQIPKPFHGVVPS-- 228
            ::  |:..|...:::|...|                      :|.|......:|..|:||:|.  
 Worm    83 KL--KLNGYSFGFYEGNCPP----------------------VYGPARNCFYVPHHFYGVLPENG 123

  Fly   229 -----SVSMVEKECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILG 288
                 |:.:..:|...:    .::  ......:||..||:: :.:.|.... .:|.:||.....|
 Worm   124 VVQKVSIQLGHREAFLS----EIV--EIGKSYEKGLTVCLQ-IVYYYSQWQ-NVILYIEAWRAQG 180

  Fly   289 ADKIYFYNLQVHPNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLTKKTNHKRQNEVIPY 353
            |.:...|......:..|||::||:.|.:::.|      .|||...             .:.:.||
 Worm   181 ATRFIVYFHSATQDTKKVLDYYEKLGLIELRP------WPNVGAL-------------SSYIAPY 226

  Fly   354 NDCLYKNLYLY-DYIAL--------------LDIDEVIMPKGGAVL-WSELM 389
            :..:..::::. .:|||              .|.|||::|..|:|| ::||:
 Worm   227 HPKIDDSVFIIASHIALQVCSLEIRTELGIVADFDEVMVPGDGSVLEYAELV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 36/149 (24%)
ZK1025.4NP_001040719.1 Glyco_transf_92 151..395 CDD:366762 36/149 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.