DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3655 and R07B7.12

DIOPT Version :9

Sequence 1:NP_001259118.1 Gene:CG3655 / 31056 FlyBaseID:FBgn0040397 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_506032.1 Gene:R07B7.12 / 187659 WormBaseID:WBGene00011096 Length:550 Species:Caenorhabditis elegans


Alignment Length:294 Identity:51/294 - (17%)
Similarity:92/294 - (31%) Gaps:105/294 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 ECDTATNNLRVIYNRPPDDQKKGFAVCVKGLDFLYDDLSVRLIEWIEMLNILGADKIYFYNLQVH 300
            |.::|...:::.:..|..:......:|:          |.:.:          |:|...:.:.:|
 Worm   181 EIESAGTRVQIPFREPRKNSHSPVIICI----------SPQFV----------AEKWQLFLMNIH 225

  Fly   301 PNITKVLNHYEQEGKVQVIPLTLPGGQPNVPGFQHLYLT-------------------------- 339
                 |:..|                    .|..|:|:|                          
 Worm   226 -----VIRRY--------------------GGHMHIYITSMVEKLFNVLKIYEDMEALTIDYWIR 265

  Fly   340 ---KKT---------NHKRQNEVIPYNDCLYKNLYLYDYIALLDIDEVIMPKGGAVLWSELMD-- 390
               |||         |.:.:::.....|||.:...:.::||..|||::::|........|...  
 Worm   266 MKLKKTSSPVADIMKNVEWRHQAGAQTDCLLQYKEVAEFIAFFDIDDILVPNFSHNYHQEFSSHF 330

  Fly   391 KVRPESRKI---KPDGF-------HSYNFRNVYFLDDQQHEHGWHKDIP---KY----MHMLQHV 438
            ...|....|   |.|.|       ..::||:::.....|.|.|:.|.|.   ||    :|....:
 Worm   331 NAYPSYHSIFYGKRDVFVEKISSIEDFSFRHLFSNMKIQEETGYGKSIVNPLKYNSTWIHHSMKL 395

  Fly   439 HRAKNYTKPNQ---YVKCFHDPERVLTLHNHFPL 469
            .|.|.....|.   ::|...|.|.......|.|:
 Worm   396 PRNKMLKIMNTEIIHIKNILDSELNKDAPIHLPI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3655NP_001259118.1 Glyco_transf_92 257..527 CDD:279961 48/273 (18%)
R07B7.12NP_506032.1 Glyco_transf_92 203..455 CDD:279961 48/272 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D561250at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.